Answered

Discover new perspectives and gain insights with IDNLearn.com. Our experts provide timely and precise responses to help you understand and solve any issue you face.

The first few amino acids of the protein hemoglobin are given below: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALT How many alpha helices would you predict here? Show your predictions! Remember that proline CANNOT be in an alpha helix and are typically found at the ends of helices. Glycine can be in a helix, but only up to twice in any one helix. Use the propensity table above to give your best answer.

Sagot :

Grimm0047idn
To predict alpha helices in the hemoglobin sequence:

1. Identify Proline Residues:
- Proline (P) cannot be in an alpha helix: found at positions 4, 23, and 48.

2. Identify Glycine Residues:
- Glycine (G) can be in an alpha helix but typically no more than twice per helix: found at positions 16, 17, 25, 26, 35, 50, 51, and 55.

Predicted Alpha Helices:
1. First Helix: From the start (M1) to L3 (before P4).
2. Second Helix: From D6 to G17 (no prolines and acceptable glycine count).
3. Third Helix: From A28 to T47 (no prolines and acceptable glycine count).

Thus, there are three predicted alpha helices in the sequence:

1. M1-L3
2. D6-G17
3. A28-T47
Thank you for participating in our discussion. We value every contribution. Keep sharing knowledge and helping others find the answers they need. Let's create a dynamic and informative learning environment together. Thank you for visiting IDNLearn.com. We’re here to provide dependable answers, so visit us again soon.